PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YYX61
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 363aa    MW: 39096.8 Da    PI: 5.7334
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YYX61genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.96e-30149202155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araip.YYX61 149 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 202
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.041146205IPR017930Myb domain
SuperFamilySSF466892.15E-19147206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-30148207IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23150202IPR006447Myb domain, plants
PfamPF002496.7E-8152201IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGEEVKIADY PGGGADDERV SEWELGLPSP ADLPPLSQAL IPPELASAFS ISPEPYRTLL  60
DVNRASQDTI SAIRGGASQA FSSSNFQLDD RATVFEPDAT AFADEELEPD RDGSGSDSRK  120
LRKIDSAAEE ADSAAPPAND DPSARSMKRP RLVWTPQLHK RFVDVVAHLG IKNAVPKTIM  180
QLMNVEGLTR ENVASHLQKY RLYLKRMQGL SNEGPSSSDQ LFASTPVPQS LHESGGAGGS  240
AGHSHGNGHL PVPIPLPYPA PPAMMPMPML GMPPMSMAVG NHHGFNPLAQ QRDWSGANKF  300
GSVVSYPQSH SQGVTPNSNV KLMVIPSSQF RSSLNIVDKA VEVCQHWVEY RLGIQDGSPH  360
TSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20146207263ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171967.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB44e-89PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ01e-125F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-82G2-like family protein